PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009611248.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 755aa    MW: 84502.5 Da    PI: 6.5162
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009611248.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.15.6e-2297152156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe+lF+++++p++++r++L+++lgL  rqVk+WFqNrR++ k
  XP_009611248.1  97 KKKYHRHTAHQIRELEALFKESPHPDEKQRQQLSNQLGLHPRQVKFWFQNRRTQIK 152
                     79999***********************************************9877 PP

2START222.21.6e-692724934206
                     HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
           START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                     ++a++el k+a+ +ep+W ks     e++n+de++++f+++k+      +s+ea+r++gvv m+l++lv+ ++d++ qW+et++    ka+tl+v
  XP_009611248.1 272 NQATEELKKMATFGEPLWIKSFetgrEILNYDEYMKEFPTEKSgeerltRSIEASRDTGVVSMDLPRLVQCFMDVN-QWKETFPgmitKASTLDV 365
                     67899****************99*****************999*********************************.****************** PP

                     ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
           START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                     i++g      ga+qlm+aelq+l+p+v  R+++f+Ry++qlga++w+ivdvSvd  +++  ++s++++++lpSg+++++ sn h+kvtwveh ++
  XP_009611248.1 366 IRNGegdnwvGAVQLMFAELQMLTPVVGtRKVYFLRYCKQLGADQWAIVDVSVDKVEDNI-DASLMKCRKLPSGCILQDQSNAHCKVTWVEHLEC 459
                     **********************************************************98.9********************************* PP

                     -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                     + +++h+l++ +v+sg+a+ga++w+atlq+qce+
  XP_009611248.1 460 QQSTVHSLYHAIVNSGQAFGARHWMATLQQQCER 493
                     ********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-2285148IPR009057Homeodomain-like
SuperFamilySSF466898.36E-2185155IPR009057Homeodomain-like
PROSITE profilePS5007117.89694154IPR001356Homeobox domain
SMARTSM003891.5E-1996158IPR001356Homeobox domain
PfamPF000462.7E-1997152IPR001356Homeobox domain
CDDcd000863.58E-1897152No hitNo description
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PROSITE profilePS5084836.831260496IPR002913START domain
SuperFamilySSF559617.0E-32262494No hitNo description
CDDcd088751.51E-108264492No hitNo description
SMARTSM002341.3E-62269493IPR002913START domain
PfamPF018523.1E-56272493IPR002913START domain
Gene3DG3DSA:3.30.530.202.9E-4317477IPR023393START-like domain
SuperFamilySSF559611.51E-11525747No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MKFVDMSNNT PSNSHAKDFA SPALTLSLAG IFRDGAAGNE ETEEVDDGSA GGGRREETTM  60
VEISSENSVP LMSTLSRSRD DFDAENEDYD DPTNSKKKKY HRHTAHQIRE LEALFKESPH  120
PDEKQRQQLS NQLGLHPRQV KFWFQNRRTQ IKAIQERHEN SLLKTEIDKL REVNKALRMA  180
MKKNIPSCPS CGFSSSSKEA AVVIPTQEQQ LRIENARPKT EVEKLRAELG KYTKGTSPTT  240
TSEGNDEENK NGLELQTNTF GLEKSRIMDI VNQATEELKK MATFGEPLWI KSFETGREIL  300
NYDEYMKEFP TEKSGEERLT RSIEASRDTG VVSMDLPRLV QCFMDVNQWK ETFPGMITKA  360
STLDVIRNGE GDNWVGAVQL MFAELQMLTP VVGTRKVYFL RYCKQLGADQ WAIVDVSVDK  420
VEDNIDASLM KCRKLPSGCI LQDQSNAHCK VTWVEHLECQ QSTVHSLYHA IVNSGQAFGA  480
RHWMATLQQQ CERLTFFKAT SVRIKDSTGP DVATLAGRKS ILKLAQRMTW SFCHAIGASS  540
YNKWDKIHSK TGDDIRVASR KNLTDPREPF GLILCATSSV WLPFSRNVLF DFLRDETRQH  600
ECNIMSNGGP VESIANLATG QDRGNAVTIQ AMKLKEDMWI LQDTCTNAYE STVVYAPIDI  660
GGMKSVMTGR DSSNVAVLPS GFSILPDGLE SRSLVITSRP EEKCTGGGSL LTVLYQILTS  720
NSPAVKLSKE SVESVNNLIS CTLHRIKTSL QCEDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611248.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2 isoform X1
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A0V0IS600.0A0A0V0IS60_SOLCH; Putative homeobox-leucine zipper protein GLABRA 2-like
STRINGPGSC0003DMT4000067700.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62282328
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein